Transcript | Ll_transcript_175606 |
---|---|
CDS coordinates | 3-302 (+) |
Peptide sequence | FQWNLTTLIAFEELKRVMTQAPVLTLPNFTQPFEIECDASGKGIGAFLMSNRQPIAYCSMALSPNNLCKSTYEKELMTLVLAVQHWRPYLLGRSFKVYS* |
ORF Type | 5prime_partial |
Blastp | Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 40% of identity |
---|---|
Blastx | Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 40% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020207083.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer