Protein coding transcript 131135

• Transcript: Ll_transcript_134046
• CDS coordinates: 3-722 (+)
• Peptide sequence: FVLLLVVERDRPCSFSTNFRHTFWLLNLGLGRSLKMGGYKYVQEVYRKKQSDVLRYLLRIRVWQYRQMTRVHRAPRPTRPDKARRLGYKAKQGFSIFRVRIRRGGRKRPVPKGATYGKPKSHGVNELKPKRCLQSIAEERVGRRCGGLRVLNSYWVGQDSTFKFYEVITVDTAHPAIRRDAKINWICNAVHKHRELRGKTSAGRSSRGLGKGHGFSQTTGGSRKACWKRKNTLQLHRKR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_134046

• Blastp: 60S ribosomal protein L15 from Sophophora with 77.45% of identity
• Blastx: 60S ribosomal protein L15 from Sophophora with 77.45% of identity
• Eggnog: Ribosomal protein L15(COG1632)
• Kegg: Link to kegg annotations (Dmel_CG17420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016202086.1)
• Pfam: Ribosomal L15 (PF00827.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;