Protein coding transcript 131143

• Transcript: Ll_transcript_134047
• CDS coordinates: 3-368 (+)
• Peptide sequence: TSASKNYNKMVRINVLADALKTINNAEKRGKRQVLIRPNSKVIVKFLGVMMKKGYIGEFEIVDDHRAGKIVVNLTGRLNKCGVISPRFDVPIRDIEKWTNNLLPSRQFGYVVLTTSGGIMDH
• ORF Type: internal

Annotations of Ll_transcript_134047

• Blastp: 40S ribosomal protein S15a from Sophophora with 92.04% of identity
• Blastx: 40S ribosomal protein S15a from Sophophora with 92.04% of identity
• Eggnog: One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit (By similarity)(COG0096)
• Kegg: Link to kegg annotations (Dyak_GE16163)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014505890.1)
• Pfam: Ribosomal protein S8 (PF00410.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;