Protein coding transcript 131147

• Transcript: Ll_transcript_104027
• CDS coordinates: 3-425 (+)
• Peptide sequence: LIMNSYQFINPVKDRELDLRGYKIPLIENMGATLDQFDTIDFSDNDIRKIDGFAYLKRLKNLIFNNNAIVRISDNLEQCLPNLESLILTGNQIQELGDLDPLASLPKLKMLSLLHNPVASKEHYRLYVAHKIPQVRILDFR
• ORF Type: internal

Annotations of Ll_transcript_104027

• Blastp: U2 small nuclear ribonucleoprotein A' from Mus with 66.67% of identity
• Blastx: U2 small nuclear ribonucleoprotein A' from Mus with 66.67% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (68981)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016198385.1)
• Pfam: Leucine-rich repeat (PF14580.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;