Protein coding transcript 131149

• Transcript: Ll_transcript_104024
• CDS coordinates: 3-416 (+)
• Peptide sequence: TQKQTPRHPYLSLHVAITSLFVLLLMDSHSPKIYSNGLKTSLAVILIISPTLFPSNSQGSPSTKDNKGMMKQMKLVLGSRPPRCINKCLNCRPCMAALVISPHHKDGHIHKATTSQRDESYYLLSWKCKCGNKFFQP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_104024

• Blastp: EPIDERMAL PATTERNING FACTOR-like protein 8 from Arabidopsis with 37.5% of identity
• Blastx: EPIDERMAL PATTERNING FACTOR-like protein 8 from Arabidopsis with 37.5% of identity
• Eggnog: NA(ENOG4111DSG)
• Kegg: Link to kegg annotations (AT1G80133)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462627.1)
• Pfam: Epidermal patterning factor proteins (PF17181.3)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;