Transcript | Ll_transcript_104024 |
---|---|
CDS coordinates | 3-416 (+) |
Peptide sequence | TQKQTPRHPYLSLHVAITSLFVLLLMDSHSPKIYSNGLKTSLAVILIISPTLFPSNSQGSPSTKDNKGMMKQMKLVLGSRPPRCINKCLNCRPCMAALVISPHHKDGHIHKATTSQRDESYYLLSWKCKCGNKFFQP* |
ORF Type | 5prime_partial |
Blastp | EPIDERMAL PATTERNING FACTOR-like protein 8 from Arabidopsis with 37.5% of identity |
---|---|
Blastx | EPIDERMAL PATTERNING FACTOR-like protein 8 from Arabidopsis with 37.5% of identity |
Eggnog | NA(ENOG4111DSG) |
Kegg | Link to kegg annotations (AT1G80133) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462627.1) |
Pfam | Epidermal patterning factor proteins (PF17181.3) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer