Protein coding transcript 131151

• Transcript: Ll_transcript_104023
• CDS coordinates: 3-308 (+)
• Peptide sequence: ELKKNKKQRMIVRTAVLKGKDPLQILAEMEKIDQMEYNVVQPSPLNEKVLREKRRKLKETFDRVMKMYVKDELDKYHEIKRAESEYEKRRFKLISYFDAVKT
• ORF Type: internal

Annotations of Ll_transcript_104023

• Blastp: WW domain-binding protein 11 from Mus with 59.8% of identity
• Blastx: WW domain-binding protein 11 from Homo with 59.8% of identity
• Eggnog: WW domain binding protein 11(ENOG41115S5)
• Kegg: Link to kegg annotations (60321)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020223530.1)
• Pfam: WW domain binding protein 11 (PF09429.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;