Protein coding transcript 131153

• Transcript: Ll_transcript_244333
• CDS coordinates: 172-606 (+)
• Peptide sequence: MTDMFEKQTSSDVSNYASSSGLSGDDKEIGYGSATFKHRYLSVKNSVFHFLPFKIDLNFARMVMAEVMGTFILMFCVCGIIATTQLQNGAVGLLEYAATAGLTVVVIIFSIGPISCAHVNPAVTIAFATLGHFPWIKVPIYIIAQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_244333

• Blastp: Probable aquaporin NIP7-1 from Arabidopsis with 57.5% of identity
• Blastx: Probable aquaporin NIP7-1 from Arabidopsis with 57.5% of identity
• Eggnog: Channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity (By similarity)(COG0580)
• Kegg: Link to kegg annotations (AT3G06100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452694.1)
• Pfam: Major intrinsic protein (PF00230.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;