Protein coding transcript 131155

• Transcript: Ll_transcript_244330
• CDS coordinates: 3-386 (+)
• Peptide sequence: IERQMDAVTAIGMGLQGSLEDQLHQLKQYEQNVFAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETLRVGWEQLLTSINRNVNEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKS
• ORF Type: internal

Annotations of Ll_transcript_244330

• Blastp: Alpha-actinin, sarcomeric from Sophophora with 91.41% of identity
• Blastx: Alpha-actinin, sarcomeric from Sophophora with 91.41% of identity
• Eggnog: Microtubule associated monoxygenase, calponin and LIM domain containing(COG5069)
• Kegg: Link to kegg annotations (Dmel_CG4376)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457745.1)
• Pfam: Spectrin repeat (PF00435.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;