Protein coding transcript 131161

• Transcript: Ll_transcript_244343
• CDS coordinates: 2-319 (+)
• Peptide sequence: REWHHWLVGNIPGNDIAKGETLSEYVGSGPPPETGLHRYVFLAYKQPSKLNFDEPRLTNRSAEKREKFSIAKFALKYNLGNPVAGNFYQAQYDDYVPLLYKQLGA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_244343

• Blastp: Phosphatidylethanolamine-binding protein homolog F40A3.3 from Caenorhabditis with 65.09% of identity
• Blastx: Phosphatidylethanolamine-binding protein homolog F40A3.3 from Caenorhabditis with 65.09% of identity
• Eggnog: phosphatidylethanolamine-binding protein(COG1881)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013443336.1)
• Pfam: Phosphatidylethanolamine-binding protein (PF01161.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;