Protein coding transcript 131164

• Transcript: Ll_transcript_235900
• CDS coordinates: 1-582 (+)
• Peptide sequence: MDGAIRNGLGKDTNPSSIVKCYVTYVQDLPNGTERGKFLALDLGGTNFRVLLIELGENNYFHMDSEIFKVPAHIQTGKGSELFDHIAKCLAEFIKKHNLDSKKALPLGFTFSFPLRQVGLTKGYLNSWTKGFNCSGVVDEDVVRLLKEAIKRRKDVEIDVCGILNDTTGTIMSCAWKNPNTKIGVIVGTGCNAC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_235900

• Blastp: Hexokinase type 2 from Sophophora with 55.67% of identity
• Blastx: Hexokinase type 2 from Sophophora with 55.67% of identity
• Eggnog: hexokinase(COG5026)
• Kegg: Link to kegg annotations (Dmel_CG32849)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014517873.1)
• Pfam: Hexokinase (PF00349.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;