Protein coding transcript 131165

• Transcript: Ll_transcript_235907
• CDS coordinates: 1-351 (+)
• Peptide sequence: SISIGNLEQYLPFILREIDMQPKRQYLLLHSLKEIITFESSTPNGIENLKPFVPAIWQQLFKHCECTEEGSRNVVAECLGKLTLIDPYSLLPNLQLSLSSSSALMRTTLLTAVKFTI
• ORF Type: internal

Annotations of Ll_transcript_235907

• Blastp: Cullin-associated NEDD8-dissociated protein 1 from Sophophora with 64.96% of identity
• Blastx: Cullin-associated NEDD8-dissociated protein 1 from Sophophora with 64.96% of identity
• Eggnog: cullin-associated and neddylation-dissociated(ENOG410XPK4)
• Kegg: Link to kegg annotations (Dmel_CG5366)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440423.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;