Transcript | Ll_transcript_235907 |
---|---|
CDS coordinates | 1-351 (+) |
Peptide sequence | SISIGNLEQYLPFILREIDMQPKRQYLLLHSLKEIITFESSTPNGIENLKPFVPAIWQQLFKHCECTEEGSRNVVAECLGKLTLIDPYSLLPNLQLSLSSSSALMRTTLLTAVKFTI |
ORF Type | internal |
Blastp | Cullin-associated NEDD8-dissociated protein 1 from Sophophora with 64.96% of identity |
---|---|
Blastx | Cullin-associated NEDD8-dissociated protein 1 from Sophophora with 64.96% of identity |
Eggnog | cullin-associated and neddylation-dissociated(ENOG410XPK4) |
Kegg | Link to kegg annotations (Dmel_CG5366) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440423.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer