Protein coding transcript 131166

• Transcript: Ll_transcript_165856
• CDS coordinates: 70-501 (+)
• Peptide sequence: MAFTPAFVEQLPALNGLGFGMARVELEEGGVVPIHTHVDATEVIIPTGGSFTIGFISSDNKVYMKTISEGNIFVIPKGLLHFGLNAGKGKHSAVYVFSSEHRSLQVVDLALFGSDLDSNIIAKTTFLDIEQIKKLKAVFKGSG*
• ORF Type: complete

Annotations of Ll_transcript_165856

• Blastp: Auxin-binding protein ABP20 from Prunus with 51.06% of identity
• Blastx: Auxin-binding protein ABP20 from Prunus with 49.7% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447311.1)
• Pfam: Cupin (PF00190.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;