Protein coding transcript 131172

• Transcript: Ll_transcript_46474
• CDS coordinates: 3-314 (+)
• Peptide sequence: QLTHKLFAVQCAYYNVTVCVTLRNILLNFESVPVFLASKKMMPLVSDKSIAPALENKPAEEPKKLKACCACPDTKRVRDACIMENGEEKCGHLIEAHKECMRKM
• ORF Type: internal

Annotations of Ll_transcript_46474

• Blastp: Cytochrome c oxidase copper chaperone from Canis with 60.32% of identity
• Blastx: Cytochrome c oxidase copper chaperone from Canis with 60.32% of identity
• Eggnog: cytochrome C oxidase(ENOG410XVYQ)
• Kegg: Link to kegg annotations (503668)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015954078.1)
• Pfam: Cytochrome C oxidase copper chaperone (COX17) (PF05051.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;