Protein coding transcript 131174

• Transcript: Ll_transcript_46501
• CDS coordinates: 1-297 (-)
• Peptide sequence: RFERICPPNGENRVVIYTTTLRGVRRTFEACNAVRSGFEAFGVLICERDVSMDNGFKEELRELLRGKEKEAMVPPRVFVKGFYIGGAEEMLKVVEEGLL
• ORF Type: internal

Annotations of Ll_transcript_46501

• Blastp: Uncharacterized protein At5g39865 from Arabidopsis with 47.83% of identity
• Blastx: Uncharacterized protein At5g39865 from Arabidopsis with 46.53% of identity
• Eggnog: Glutaredoxin(ENOG4111HAI)
• Kegg: Link to kegg annotations (AT5G39865)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446154.1)
• Pfam: Glutaredoxin (PF00462.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;