Transcript | Ll_transcript_46502 |
---|---|
CDS coordinates | 126-1079 (+) |
Peptide sequence | MGCVSSNLLNHEDEFTQLGSTALGHHIVSLTSTTYGLLTLDPPPSSAAATTTVSTPSTPPPRLSFPSSLSEPKSLWSEPKPLRSEPDEVINSWELMAGLDNIESFRFSPLPPPKPFKDSNFNKENSNPNRFTTGSRTFPKKPVSTVTKRFERICPPNGENRVVIYTTTLRGVRRTFEACNAVRSGFEAFGVLICERDVSMDNGFKEELRELLRGKEKEAMVPPRVFVKGFYIGGAEEMLKVVEEGLLGELLEGLPRKKIGDICDGCGDMRFLPCFQCNGSCKVVKEEDLGQKQRRRSVMVKCSDCNENGLVVCPLCG* |
ORF Type | complete |
Blastp | Uncharacterized protein At5g39865 from Arabidopsis with 36.08% of identity |
---|---|
Blastx | Uncharacterized protein At5g39865 from Arabidopsis with 35.57% of identity |
Eggnog | Glutaredoxin(ENOG4111HAI) |
Kegg | Link to kegg annotations (AT5G39865) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446154.1) |
Pfam | Glutaredoxin (PF00462.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer