Protein coding transcript 131182

• Transcript: Ll_transcript_227762
• CDS coordinates: 2-574 (+)
• Peptide sequence: RDTPGLTVAKKEDKLGIRASGTCMVHFDNVKVPDSHILGEIGKGYKYAIEVLNEGRIGIGAQMVGLAQGCFNATIPYTLERTQFGKRIFDFQGMQHQIAQIATQIESARLLVYNASRLHDAGKDIIKEGAMAKYWACEVAANTTSKCVDWMGGVGFTKDFPQEKYYRDCKIGSIYEGTSNIQLNTIAKMLE
• ORF Type: internal

Annotations of Ll_transcript_227762

• Blastp: Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial from Homo with 70.16% of identity
• Blastx: Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial from Homo with 70.16% of identity
• Eggnog: acyl-CoA dehydrogenase(COG1960)
• Kegg: Link to kegg annotations (36)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014628589.1)
• Pfam: Acyl-CoA dehydrogenase, C-terminal domain (PF00441.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;