| Transcript | Ll_transcript_227786 |
|---|---|
| CDS coordinates | 65-469 (+) |
| Peptide sequence | MKGGSIEGGEISKGVSIRKGMTKGLSIMDFILRIVAAIATLASAVSMATTNETLPFVTQFVRFRAEFDDLPTFMFFVTANSVVSGYLVLSLVLSIFHIVRSSAVKTRILLVALDTVMLGLLTAAASAAAAIVYIA |
| ORF Type | 3prime_partial |
| Blastp | CASP-like protein 7 from Soja with 74.07% of identity |
|---|---|
| Blastx | CASP-like protein 7 from Soja with 74.17% of identity |
| Eggnog | cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion(ENOG410YGEC) |
| Kegg | Link to kegg annotations (100500346) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456216.1) |
| Pfam | Domain of unknown function (DUF588) (PF04535.11) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer