Protein coding transcript 131193

• Transcript: Ll_transcript_96935
• CDS coordinates: 1-519 (+)
• Peptide sequence: MECNNPVHITLDTTLKNDNMGLKAYVSTQIGVPGGKTGNMFINVPIEVTCYQPETVGLSLCQKTVAVGQKCQEPIAELVQIEEASSKISDLLEVVLSYIDKVLASSDCNAADNSHIGRILLDLMHSVPHVTPDRFEEMFNSNVKDLLMVITLSQLTKTQLELNEKLTLLSLS*
• ORF Type: complete

Annotations of Ll_transcript_96935

• Blastp: Eukaryotic translation initiation factor 3 subunit F-1 from Drosophila with 59.3% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit F-1 from Drosophila with 57.32% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(COG1310)
• Kegg: Link to kegg annotations (Dvir_GJ23292)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016180740.1)
• Pfam: Maintenance of mitochondrial structure and function (PF13012.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;