Transcript | Ll_transcript_96935 |
---|---|
CDS coordinates | 1-519 (+) |
Peptide sequence | MECNNPVHITLDTTLKNDNMGLKAYVSTQIGVPGGKTGNMFINVPIEVTCYQPETVGLSLCQKTVAVGQKCQEPIAELVQIEEASSKISDLLEVVLSYIDKVLASSDCNAADNSHIGRILLDLMHSVPHVTPDRFEEMFNSNVKDLLMVITLSQLTKTQLELNEKLTLLSLS* |
ORF Type | complete |
Blastp | Eukaryotic translation initiation factor 3 subunit F-1 from Drosophila with 59.3% of identity |
---|---|
Blastx | Eukaryotic translation initiation factor 3 subunit F-1 from Drosophila with 57.32% of identity |
Eggnog | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(COG1310) |
Kegg | Link to kegg annotations (Dvir_GJ23292) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016180740.1) |
Pfam | Maintenance of mitochondrial structure and function (PF13012.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer