Protein coding transcript 131197

• Transcript: Ll_transcript_96945
• CDS coordinates: 2-382 (-)
• Peptide sequence: VVAFTTMVDGYAKSGDMAASRFLFQQAKEKDIVAWSALISGYVQNGQPNQALKVFLEMESENVKPDEFILVSLMSACSQLGSLELAQWVDSYVSKSSIDLQQDHVVAALLDMNAKCGNMERASKLFE
• ORF Type: internal

Annotations of Ll_transcript_96945

• Blastp: Putative pentatricopeptide repeat-containing protein At5g37570 from Arabidopsis with 59.84% of identity
• Blastx: Putative pentatricopeptide repeat-containing protein At5g37570 from Arabidopsis with 59.84% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G37570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444229.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;