Protein coding transcript 131198

• Transcript: Ll_transcript_96959
• CDS coordinates: 3-395 (+)
• Peptide sequence: KFKDLIHYYVLVGVIPLTLFVTGVNVFIGPAKLAPIPEGYRPAHWEYHQHPITRWMARYIYPSPQQQYEKYLHTLYEEDEKFKVRMLTHKIDEMMKDRSDYKSFYYRPISANHHRVVKESMDRQESEGLN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_96959

• Blastp: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial from Macaca with 44.95% of identity
• Blastx: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial from Macaca with 44.95% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101866824)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020221803.1)
• Pfam: NADH:ubiquinone oxidoreductase, NDUFB5/SGDH subunit (PF09781.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;