Protein coding transcript 131199

• Transcript: Ll_transcript_96939
• CDS coordinates: 2-376 (+)
• Peptide sequence: SNSFIEALVNHDSTFRARYECCFLWVDVSLPVLHSSLSARVDRMIEAGQLEEVREFFEHSISDYTRGVGRAIGVPEFDEFLREEESTYGDESKKKKLLETAIAMTKVNNWKLASRQVQKINRLYT
• ORF Type: internal

Annotations of Ll_transcript_96939

• Blastp: Adenylate isopentenyltransferase 5, chloroplastic from Arabidopsis with 60.48% of identity
• Blastx: Adenylate isopentenyltransferase 5, chloroplastic from Arabidopsis with 60.48% of identity
• Eggnog: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A) (By similarity)(COG0324)
• Kegg: Link to kegg annotations (AT5G19040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436039.1)
• Pfam: IPP transferase (PF01715.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;