Protein coding transcript 131203

• Transcript: Ll_transcript_183075
• CDS coordinates: 53-427 (+)
• Peptide sequence: MAKLTRERKRKSAINEVVTRVYTINMHKRLLNIGFKKRAPRAIKEIRKFATQQMGTQDVRIDTRLNKFVWSKGIRSVPFRIRVQLARRRNDDEDSPHKLYTLVTWVNVPTFKKLGTENVDGTEE*
• ORF Type: complete

Annotations of Ll_transcript_183075

• Blastp: 60S ribosomal protein L31 from Pongo with 75.68% of identity
• Blastx: 60S ribosomal protein L31 from Pongo with 75.68% of identity
• Eggnog: (ribosomal) protein(COG2097)
• Kegg: Link to kegg annotations (100172356)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017440325.1)
• Pfam: Ribosomal protein L31e (PF01198.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;