Protein coding transcript 131204

• Transcript: Ll_transcript_183058
• CDS coordinates: 2-436 (+)
• Peptide sequence: KGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSGGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDSALLRPGRLDQLIYIPLPDEESRYQIFKACTRKSPVSKDVDLSALAKYTQGFSGADI
• ORF Type: internal

Annotations of Ll_transcript_183058

• Blastp: Cell division control protein 48 homolog D from Arabidopsis with 95.17% of identity
• Blastx: Cell division control protein 48 homolog D from Arabidopsis with 95.17% of identity
• Eggnog: Aaa atpase(COG0464)
• Kegg: Link to kegg annotations (AT3G53230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451653.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;