Transcript | Ll_transcript_152206 |
---|---|
CDS coordinates | 1-312 (+) |
Peptide sequence | ASIIGDAVQYVHELQAQAKKLKVEVTALETSLLVSENYQGSIKNPLKFHAPHNMHPISKKIMQIDMLQVEEKGYYTKIVSNKGEGVATSLYKALESLSGFNVQN |
ORF Type | internal |
Blastp | Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR from Arabidopsis with 56.19% of identity |
---|---|
Blastx | Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR from Arabidopsis with 56.19% of identity |
Eggnog | Transcription factor(ENOG410YQ9Q) |
Kegg | Link to kegg annotations (AT2G28160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447804.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer