Protein coding transcript 131211

• Transcript: Ll_transcript_152206
• CDS coordinates: 1-312 (+)
• Peptide sequence: ASIIGDAVQYVHELQAQAKKLKVEVTALETSLLVSENYQGSIKNPLKFHAPHNMHPISKKIMQIDMLQVEEKGYYTKIVSNKGEGVATSLYKALESLSGFNVQN
• ORF Type: internal

Annotations of Ll_transcript_152206

• Blastp: Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR from Arabidopsis with 56.19% of identity
• Blastx: Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR from Arabidopsis with 56.19% of identity
• Eggnog: Transcription factor(ENOG410YQ9Q)
• Kegg: Link to kegg annotations (AT2G28160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447804.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;