Protein coding transcript 131220

• Transcript: Ll_transcript_247225
• CDS coordinates: 1-369 (+)
• Peptide sequence: EHLVNHMLTHSNETPFRCETCGKTFVRKEHFTSHIMWHTGETPHQCDLCGKKFTRKEHLLNHVRQHTGETPHHCEYCPKKFSRKEHLIIHTRLHTGEMPHQCEYCPKKFSRKEHLIIHTRQHT
• ORF Type: internal

Annotations of Ll_transcript_247225

• Blastp: Zinc finger and SCAN domain-containing protein 22 from Homo with 49.18% of identity
• Blastx: Zinc finger and SCAN domain-containing protein 22 from Homo with 49.18% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (342945)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003591873.2)
• Pfam: Zinc finger, C2H2 type (PF00096.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;