Protein coding transcript 131222

• Transcript: Ll_transcript_198509
• CDS coordinates: 3-311 (+)
• Peptide sequence: NVEDAVENIDIGGVTLLRAAAKNHERVTVLCDPADYLVISNEISLNKDTLLETRKKLALKAFTHTATYDDCISDYFRKKFAGGESQMNLRYGMNPHQCPAQLF
• ORF Type: internal

Annotations of Ll_transcript_198509

• Blastp: Bifunctional purine biosynthesis protein PURH from Homo with 73.08% of identity
• Blastx: Bifunctional purine biosynthesis protein PURH from Homo with 73.08% of identity
• Eggnog: bifunctional purine biosynthesis protein PURH(COG0138)
• Kegg: Link to kegg annotations (471)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003617820.2)
• Pfam: AICARFT/IMPCHase bienzyme (PF01808.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;