Protein coding transcript 131225

• Transcript: Ll_transcript_205910
• CDS coordinates: 2-382 (+)
• Peptide sequence: FIEMPSWPCDPERTIILHKPKTNEIVSYGSGYGGNSLLGKKCFALRIGSTIAKREGWLAEHMLILGITNPKGKKRYIAAAFPSACGKTNLAMMTPTLPGYKIECVGDDIAWMRFDKDGKLRAINLEN
• ORF Type: internal

Annotations of Ll_transcript_205910

• Blastp: Phosphoenolpyruvate carboxykinase [GTP] from Sophophora with 83.33% of identity
• Blastx: Phosphoenolpyruvate carboxykinase [GTP] from Sophophora with 83.33% of identity
• Eggnog: Catalyzes the conversion of oxaloacetate (OAA) to phosphoenolpyruvate (PEP), the rate-limiting step in the metabolic pathway that produces glucose from lactate and other precursors derived from the citric acid cycle (By similarity)(COG1274)
• Kegg: Link to kegg annotations (Dmel_CG17725)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020230452.1)
• Pfam: Phosphoenolpyruvate carboxykinase N-terminal domain (PF17297.1)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;