Protein coding transcript 131226

• Transcript: Ll_transcript_205922
• CDS coordinates: 3-449 (+)
• Peptide sequence: HIMVTMGYSKKVYILFFSIFILKVSCISDDEINEFATHLQDDIKKAQNGKLATDNSKFKPDKDEEPEDFGEYDFIIVGSGATGSTLAYRLSEEKKFKILLLEAGGFPDNFTSVPFTIDLSHFTKFNWGYKSVPQKYSCLGMNNAECIIP
• ORF Type: internal

Annotations of Ll_transcript_205922

• Blastp: Oxygen-dependent choline dehydrogenase from Stenotrophomonas maltophilia group with 42.31% of identity
• Blastx: Oxygen-dependent choline dehydrogenase from Stenotrophomonas maltophilia group with 42.31% of identity
• Eggnog: oxidoreductase(COG2303)
• Kegg: Link to kegg annotations (Smlt2237)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017424476.1)
• Pfam: GMC oxidoreductase (PF00732.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;