Protein coding transcript 131228

• Transcript: Ll_transcript_205931
• CDS coordinates: 3-557 (+)
• Peptide sequence: MIDVASDLDYLHHGNSKPVVHCDLKPSNVLLDEDMVAHVCDFGIAKLLEEGQSQALTNTLATIGYIAPEYGSEGIVSIKGDVYSYGVMLMEVFTRKRPTDEMFKDGLSLRSWIKESLLPNEIIHIVDPNLMEEEELFIPPKKVALLSIMELALNCSSDSPAERMSMKEVFDSLNKIRNIFLQMV*
• ORF Type: complete

Annotations of Ll_transcript_205931

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At3g47570 from Arabidopsis with 45.99% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At3g47570 from Arabidopsis with 45.99% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G47570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418413.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;