Transcript | Ll_transcript_165193 |
---|---|
CDS coordinates | 2-709 (+) |
Peptide sequence | FFFFFFPLLSRSGLLKKLIAESSNEDGSSCVLDLHDVPGGDKTFDFVTRFCYGVKIEVTASNVVSLRCAAEYLQMNENYGEGNLVSQTESFLIEVLSNWSDTIKALQTCEEVKNISEEIHIVPRCIDSLAMKVCSGPNMFNRPKAESDCSPKQGQDPTQWNGISSETNLPPQGDDWWYEDACLLSLSLYKRLILAIEAKGMKPESVSGSLIYYIRRFVPLMNRQSSFNEKNNVNQQ |
ORF Type | internal |
Blastp | BTB/POZ domain-containing protein At5g03250 from Arabidopsis with 58.55% of identity |
---|---|
Blastx | BTB/POZ domain-containing protein At5g03250 from Arabidopsis with 59.21% of identity |
Eggnog | BTB POZ domain-containing protein(ENOG410YCM9) |
Kegg | Link to kegg annotations (AT5G03250) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420556.1) |
Pfam | NPH3 family (PF03000.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer