Protein coding transcript 131237

• Transcript: Ll_transcript_165196
• CDS coordinates: 3-575 (+)
• Peptide sequence: RSRHSYSRSRSRSRSYSGDRRRSYRSHSRGSGSRRSRHENPKPNKCLGIFGLSVYTTEHQLYDIFAKYGSIDKILIIIDAKSGRSRGFGFAYFKKHEDAKVAKEECSGMEIDGRRIRVDFSITQRPHTPTPGIYMGRPTMREERSSRRRGYDRYDNNRYDRGDRYDRGERYDRYDRDRDYDDYYEGGYRGG
• ORF Type: internal

Annotations of Ll_transcript_165196

• Blastp: Transformer-2 protein homolog beta from Rattus with 59.75% of identity
• Blastx: Transformer-2 protein homolog beta from Rattus with 68% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (117259)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462169.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;