Protein coding transcript 131242

• Transcript: Ll_transcript_198060
• CDS coordinates: 1-315 (+)
• Peptide sequence: PGKLLAIIGPVGSGKTSLFHAMLQELPLISGKMKINGEISYASQEPWLFAGSVRQNILFGLPMDRDRYKMVVKKCALQRDFSLLPYGAHTIVGDRGVSLSGGPRA
• ORF Type: internal

Annotations of Ll_transcript_198060

• Blastp: Probable multidrug resistance-associated protein lethal(2)03659 from Sophophora with 61.9% of identity
• Blastx: Probable multidrug resistance-associated protein lethal(2)03659 from Sophophora with 61.9% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (Dmel_CG8799)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014495042.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;