Transcript | Ll_transcript_198055 |
---|---|
CDS coordinates | 3-503 (+) |
Peptide sequence | RYIGVGENEVVQLFYYFVESEGNPTEDPLLLWLSGGPGCSGLCGLFFEIGPLKFNMVKYNGSLPTFSLNPHSWTKVSSIIFIDAPVGSGFAYSRTMSGYKTSDKIHAQHCHNFMRKWLVYHPKFIGNQFYIGGESYGGIPVPILAKYISDGSEAGEKPIINIKGYMA |
ORF Type | internal |
Blastp | Serine carboxypeptidase-like 18 from Arabidopsis with 56.36% of identity |
---|---|
Blastx | Serine carboxypeptidase-like 18 from Arabidopsis with 56.36% of identity |
Eggnog | carboxy-peptidase(COG2939) |
Kegg | Link to kegg annotations (AT1G33540) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434695.1) |
Pfam | Serine carboxypeptidase (PF00450.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer