Protein coding transcript 131247

• Transcript: Ll_transcript_133489
• CDS coordinates: 1-336 (+)
• Peptide sequence: GDTELSGKIKIPNLSEENDVTDLDIQISIDENDDESEKLKKIMFTKGKDVVRDQIGKYISGLKVEFSKGMILPKKDEVKPDNVKTLTSGFNKKINMTPVAIESKQIGLKIDT
• ORF Type: internal

Annotations of Ll_transcript_133489

• Blastp: Activator of 90 kDa heat shock protein ATPase homolog 2 from Mus with 39.25% of identity
• Blastx: Activator of 90 kDa heat shock protein ATPase homolog 2 from Mus with 39.25% of identity
• Eggnog: AHA1, activator of heat shock 90kDa protein ATPase homolog(COG5580)
• Kegg: Link to kegg annotations (268390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020204250.1)
• Pfam: Activator of Hsp90 ATPase, N-terminal (PF09229.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;