Protein coding transcript 131250

• Transcript: Ll_transcript_41338
• CDS coordinates: 65-460 (+)
• Peptide sequence: MNCYMVCQSRIWIVTIVFYTCIWIPLMQLKRALTSMFSFHDNKCLSEESEFPQIPTLPVARYEDLRNHCCEGGEENRRKDEICSICLVQFEGEDAVSKLKRCGHVFHVNCIEQWLDRGQFSCPFCRSLLVS*
• ORF Type: complete

Annotations of Ll_transcript_41338

• Blastp: RING-H2 finger protein ATL18 from Arabidopsis with 36.29% of identity
• Blastx: RING-H2 finger protein ATL18 from Arabidopsis with 36.97% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G38140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004497292.1)
• Pfam: Anaphase-promoting complex subunit 11 RING-H2 finger (PF12861.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;