Protein coding transcript 131253

• Transcript: Ll_transcript_257257
• CDS coordinates: 3-548 (+)
• Peptide sequence: ILRIPVEGSKVTSILWGPLDETIISGHEDGKITMWDLKMGKELHSVHDHGNSINDLQFNKDGTHFVSASKDCTAKLFDTDTLECLKTYKTERPVNSAALSPIMDHVVLGGGQEAMEVTTTSTRVGKFDARFFHLVFEEEFGRVKGHFGPINSLAFHPDGKSYASGGEDGFTRVHTFDPSYFE
• ORF Type: internal

Annotations of Ll_transcript_257257

• Blastp: Eukaryotic translation initiation factor 3 subunit I from Sophophora with 74.18% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit I from Sophophora with 74.18% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Dsec_GM18055)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464254.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;