Protein coding transcript 131256

• Transcript: Ll_transcript_274920
• CDS coordinates: 43-606 (+)
• Peptide sequence: MNAKVWELFYESDRVRDMLERLIKEESLRTYLFTYSHVYNSISMKTLSEMFELPKSTTHSIISKMIINEELMASLDDPTQTVVMHRSEPSRLQSLALQLADKVNNFVDSNERIFEMKQGNFFPRGGNQNQGQYRQNFGRQGGGGHGGHGGHGGHGGHGHGGHGGHGGHGGHGGQDWNRQRRDNRNNY*
• ORF Type: complete

Annotations of Ll_transcript_274920

• Blastp: Eukaryotic translation initiation factor 3 subunit C from Culex with 75.91% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit C from Culex with 76.47% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(ENOG410XRU3)
• Kegg: Link to kegg annotations (CpipJ_CPIJ000742)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003521511.1)
• Pfam: PCI domain (PF01399.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;