Protein coding transcript 131264

• Transcript: Ll_transcript_274938
• CDS coordinates: 3-383 (+)
• Peptide sequence: CFLRKMAGVLKATTGLTGLAVAKTPHHTLGVLYGKILRTLQKMPEDAAYRKHTQDLIQERANILQANQNVEAVEKQINCGQIEEVIVQAENELILARKMLNWKPWESLVKEAPPNQWTWPPAQPSK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_274938

• Blastp: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 from Bos with 56.52% of identity
• Blastx: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 from Bos with 56.52% of identity
• Eggnog: NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex(ENOG4111V89)
• Kegg: Link to kegg annotations (327714)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014499359.1)
• Pfam: ETC complex I subunit conserved region (PF04716.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;