Protein coding transcript 131268

• Transcript: Ll_transcript_26535
• CDS coordinates: 2-343 (+)
• Peptide sequence: FVRHQSDRYGKLKRNWRKPKGIDNRVRRRFKGQYLMPNIGYGSSVKTKHMLPTGFRKVLVHNVKELEVLMMQNRKFCGEIAHGVSAKKRKAIVERAQQLSVRLTNGNARMRSEE
• ORF Type: internal

Annotations of Ll_transcript_26535

• Blastp: 60S ribosomal protein L32 from Apis with 85.96% of identity
• Blastx: 60S ribosomal protein L32 from Apis with 85.96% of identity
• Eggnog: (ribosomal) protein(COG1717)
• Kegg: Link to kegg annotations (406099)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001238278.1)
• Pfam: Ribosomal protein L32 (PF01655.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;