| Transcript | Ll_transcript_41891 |
|---|---|
| CDS coordinates | 92-469 (+) |
| Peptide sequence | MAKSIRSKWRRKMRAIKRIRYGVKELDRLKNMLVNAGEIEVKEGGEIEHICLVKAKNEEAEKIQLEKEEKAKVDKTAEPLKETTKKVQHPTWLRKKEYKKYIKSYRKQQSINAKRIKGSIKKKSIA |
| ORF Type | 3prime_partial |
| Blastp | Protein LLP homolog from Silurana with 38.32% of identity |
|---|---|
| Blastx | - |
| Eggnog | LLP homolog, long-term synaptic facilitation (Aplysia)(ENOG4111VT9) |
| Kegg | Link to kegg annotations (407903) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | - |
| Pfam | Learning-associated protein (PF10169.8) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer