Protein coding transcript 131271

• Transcript: Ll_transcript_41896
• CDS coordinates: 2-340 (-)
• Peptide sequence: VAYFKGDNSFGPNGQVPNNWAMLSVWNSGEIFKLRLGKAPFSCLLYTKSWRFIDKIFPCFKLPTLPDFFNPFGFYFMYGVYHEGPFSGKLVRALCQFVHNMASKSKDENCKII
• ORF Type: internal

Annotations of Ll_transcript_41896

• Blastp: Probable N-acetyltransferase HLS1-like from Arabidopsis with 41.24% of identity
• Blastx: Probable N-acetyltransferase HLS1-like from Arabidopsis with 41.24% of identity
• Eggnog: Acetyltransferase (GNAT) family(ENOG410YF8W)
• Kegg: Link to kegg annotations (AT2G23060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418256.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;