Protein coding transcript 131274

• Transcript: Ll_transcript_41902
• CDS coordinates: 3-512 (+)
• Peptide sequence: AVTFGALIGGRISVVRAIYYWIAQLLGAIVAALILRLVTNNMRPNSFHVSPGVGAGHGLLLEIIMTFGLMYTVYATAIDPKRGTSGALAPLAIGLIVGANILVGGPFDGACMNPALAFGPSLVGWRWHYHWIYWVGPFIGAALAALIYEYGVIQTEPPQNHQPLAPEDY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_41902

• Blastp: Probable aquaporin TIP-type alpha from Phaseolus with 81.18% of identity
• Blastx: Probable aquaporin TIP-type alpha from Phaseolus with 81.18% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457342.1)
• Pfam: Major intrinsic protein (PF00230.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;