| Transcript | Ll_transcript_160604 |
|---|---|
| CDS coordinates | 1-297 (-) |
| Peptide sequence | EKREQILKKWTRETHLIPLRVVFVLIKLFSFYNFFSRVDDKGHNPVWKSIGYRVDTTEKLTPEERPLQKGVVETMYETDSTLIHSLIEKGLEVTEDIEQ |
| ORF Type | internal |
| Blastp | Long-chain-alcohol oxidase FAO2 from Lotus with 72.73% of identity |
|---|---|
| Blastx | Long-chain-alcohol oxidase FAO2 from Lotus with 72.73% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456494.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer