Protein coding transcript 131284

• Transcript: Ll_transcript_117494
• CDS coordinates: 2-343 (+)
• Peptide sequence: YDPEAKVMIPAHKLELWPGYKTSIRQHEKDILMCVEVTHKVLRDKTASDVLADCYRNNSQYYKEDFLKEMIGCIVITKYNNKTYRIDDIDWDRNPGYKFKFRDQEISYAEYMFN
• ORF Type: internal

Annotations of Ll_transcript_117494

• Blastp: Piwi-like protein 1 from Mus with 49.56% of identity
• Blastx: Piwi-like protein 1 from Mus with 49.56% of identity
• Eggnog: piwi-like(ENOG410XNRH)
• Kegg: Link to kegg annotations (57749)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006582596.1)
• Pfam: PAZ domain (PF02170.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;