Protein coding transcript 131285

• Transcript: Ll_transcript_117499
• CDS coordinates: 3-479 (+)
• Peptide sequence: LLFRRLLPSTVVVSSSLIFQSKNLSSITNKMAEDWKNAKSVYDFTVKDIKGEDVSLEKYKGCVLIIVNVASKCGYTSKHYKELIELDEKYRDKGLKILGFPCNQFGGQEPGDADSICSFTAKQNVKFDIFEKIDVNGNDAHPLWKYLKSKQGGLLIDSI
• ORF Type: internal

Annotations of Ll_transcript_117499

• Blastp: Probable glutathione peroxidase 2 from Arabidopsis with 58.4% of identity
• Blastx: Probable glutathione peroxidase 2 from Arabidopsis with 58.4% of identity
• Eggnog: glutathione peroxidase(COG0386)
• Kegg: Link to kegg annotations (AT2G31570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016189530.1)
• Pfam: Glutathione peroxidase (PF00255.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;