Protein coding transcript 131290

• Transcript: Ll_transcript_233545
• CDS coordinates: 2-403 (+)
• Peptide sequence: PNLTATQTHHKSSHTFPLLFPLQLSPMASRRGGVSLPERPNHPKSDQSLSLITKISRSPIVSRGKQAAGDASFVAKKLLKSTGKAAWIAGTTFLILVVPLIIEMDREQQLNEIELQQASILGTAPIAPPQSAK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_233545

• Blastp: Mitochondrial import receptor subunit TOM9-2 from Arabidopsis with 75% of identity
• Blastx: Mitochondrial import receptor subunit TOM9-2 from Arabidopsis with 75% of identity
• Eggnog: translocase of outer membrane 22-v(ENOG410YUP7)
• Kegg: Link to kegg annotations (AT5G43970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462428.1)
• Pfam: Mitochondrial import receptor subunit Tom22 (PF04281.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;