Protein coding transcript 131292

• Transcript: Ll_transcript_275838
• CDS coordinates: 3-518 (+)
• Peptide sequence: DSVRKMDDSNVKEICTPSKGVHIVLPGYYSPEQMGLLDPETSDGRVIFFLPWQKHTLSGTTDSPCAVTYNPTPTEDEISFILNEIKNYLNSDVEVRRGDVLSAWGGIRPLVSDPNKGDTQSLARNHIVHVSKSNLITIAGGKWTTYRAMAQETIDAAIQAVPELKPTKPECQ
• ORF Type: internal

Annotations of Ll_transcript_275838

• Blastp: Glycerol-3-phosphate dehydrogenase, mitochondrial from Mus with 72.33% of identity
• Blastx: Glycerol-3-phosphate dehydrogenase, mitochondrial from Mus with 72.33% of identity
• Eggnog: glycerol-3-phosphate dehydrogenase(COG0578)
• Kegg: Link to kegg annotations (14571)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003590261.1)
• Pfam: FAD dependent oxidoreductase (PF01266.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;