Protein coding transcript 131303

• Transcript: Ll_transcript_95382
• CDS coordinates: 2-676 (+)
• Peptide sequence: NGGTCRETSSSYTCDCLLGYTGGDCDQRTELRNDVHFDGAGYLEFSKELLEEKDTNTEQIIAMELSTNHSNGLIFWHGQKPNEDGQGKDYISLALVNGYLEYSYDLGSGPAIIRNSKVKVDDNERHSVILKRLGQRGTIEIDHQYMVDGESEGLQGFLNAHGNIYLGGTPNIPLMTSNRVQTGFVGCIHGFELQESRTIDLGVKAINGVNAKPCSSSRYEGNIV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_95382

• Blastp: Basement membrane proteoglycan from Caenorhabditis with 38.32% of identity
• Blastx: Basement membrane proteoglycan from Caenorhabditis with 38.32% of identity
• Eggnog: heparan sulfate proteoglycan(ENOG410XTD2)
• Kegg: Link to kegg annotations (CELE_ZC101.2)
• CantataDB: -
• Mirbase: -
• Ncbi protein: -
• Pfam: EGF-like domain (PF00008.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;