Protein coding transcript 131304

• Transcript: Ll_transcript_95374
• CDS coordinates: 1-375 (+)
• Peptide sequence: KALTAVNEPNSAETIEGEKVLNEAISTLVQSYNEIYNNEVLIIAIANNAKESRRNKRELTSMEKDLNVAEPISNDFPVIFNLILWFVVIFVFSLLAIALSIAQMDPGRDSIIYRMTSNRMKKEN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_95374

• Blastp: Renin receptor from Bos with 40.35% of identity
• Blastx: Renin receptor from Bos with 40.35% of identity
• Eggnog: ATPase, H transporting, lysosomal accessory protein 2(ENOG4111F0U)
• Kegg: Link to kegg annotations (513520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003627485.1)
• Pfam: Renin receptor-like protein (PF07850.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;