Protein coding transcript 131307

• Transcript: Ll_transcript_95368
• CDS coordinates: 79-528 (+)
• Peptide sequence: METNEKKESIEKNEKVNYRGWKVMPYIIGNETFEKLGAIGTLSNLLVYLTTVFNLDNITAYNIINIFNGSTNLATLIGAFLSDAYFGRYNTIAVSTVVSFLGLFAIQLTAAIKNLHPPECAKESSICKGPTAGQMAFLISGFVLLLIGAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_95368

• Blastp: Protein NRT1/ PTR FAMILY 2.11 from Arabidopsis with 58.5% of identity
• Blastx: Protein NRT1/ PTR FAMILY 2.11 from Arabidopsis with 62.41% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT5G62680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437978.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;